$54.42
$90.88
Product DescriptionRabbit monoclonal anti-SARS-CoV-2 spike RBD neutralizing antibody This rabbit monoclonal antibody was raised against the RBD domain of the SARS-CoV-2 S1 protein (Arg319 to Phe541, sequence below). The antibody was validated through binding assays (ELISA) and neutralization assays for its ability to neutralize SARS-CoV-2 pseudoviruses such as Ha-CoV-2 and Ha-CoV-2 variants (e.g. delta and omicron). The antibody was expressed in mammalian cells and purified as a recombinant protein. Antibody 27VBI has an extremely high affinity to RBD, and is be able to detect as low as 0.5 pg/ml RBD protein in human serum. For more information, please contact us by email:
[email protected] RBD antigen protein sequence: rvqptesivrfpnitnlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcftnvyadsfvirgdevrqiapgqtgkiadynyklpddft gcviawnsnnldskvggnynylyrlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvvlsfellhapatvcgpkkstnlvknkcvnf Application ELISA – Clone 27VBI has been validated for ELISA assay to quantify of SARS-CoV-2 spike protein. Neutralizing antibody assay – Clone 27VBI has been validated in neutralizing antibody assays for neutralizing SARS-CoV-2 pseudoviruses such as Ha-CoV-2 and Ha-CoV-2 variants. Western blot – not tested Fluorescent imaging – not tested Left, 27VBI was used in an ELISA assay to quantify SARS-CoV-2 spike RBD protein. Right, RBD protein was mixed with human serum (0.5 pg/ml) and then detected by 27VBI in an ELISA assay. Left, 27VBI was used in Ha-CoV-2 pseudovirus neutralizing antibody assay. Right, 27VBI was used in Ha-CoV-2 (Omicron) variant pseudovirus neutralizing antibody assay.
